PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1306810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 215aa    MW: 24829.9 Da    PI: 5.1772
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1306810.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.25.7e-18176380128
              NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +gyWkatg dk++ +   ++ g+kk Lvfy g+apkg kt+W+mheyrl
  Lj1g3v1306810.1  17 AGYWKATGADKPIGK--PKALGIKKALVFYVGKAPKGIKTNWIMHEYRL 63 
                      7************98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.915189IPR003441NAC domain
SuperFamilySSF1019411.24E-221389IPR003441NAC domain
PfamPF023654.6E-91763IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MVLLFSERPE VSEWFPAGYW KATGADKPIG KPKALGIKKA LVFYVGKAPK GIKTNWIMHE  60
YRLANVDRSA GKKSNLRLDD WVLCRIYNKK GKIEKYNTPT PKFSGLGEVH DSYDEHEHER  120
KPEIHDQLYM EASDSVPRLH TDSSGSEHAA SPDVTCDKEV QSEPQWNNEL EFKLDDGTFD  180
FQFSFLDDNN MSVDEYQLNQ LSPLQDMFMY LEKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-28189594174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.257940.0protoplast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1459920.0BT145992.1 Lotus japonicus clone JCVI-FLLj-17M21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523205.11e-100PREDICTED: NAC domain-containing protein 2
SwissprotQ390133e-64NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB3IX391e-146B3IX39_LOTJA; Transcription factor NAC
STRINGGLYMA04G38560.12e-99(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-65NAC family protein